1.67 Rating by ClearWebStats
utterfrugal.com is 7 years 1 month 4 weeks old. It has a .com as an domain extension. This domain is estimated value of $ 8.95 and has a daily earning of $ 0.15. While no active threats were reported recently by users, utterfrugal.com is SAFE to browse.
Get Custom Widget

Traffic Report of Utterfrugal

Daily Unique Visitors: Not Applicable
Daily Pageviews: Not Applicable

Estimated Valuation

Income Per Day: $ 0.15
Estimated Worth: $ 8.95

Search Engine Indexes

Google Indexed Pages: Not Applicable
Yahoo Indexed Pages: Not Applicable
Bing Indexed Pages: Not Applicable

Search Engine Backlinks

Google Backlinks: Not Applicable
Bing Backlinks: Not Applicable
Alexa BackLinks: Not Applicable

Safety Information

Google Safe Browsing: No Risk Issues
Siteadvisor Rating: Not Applicable
WOT Trustworthiness: Not Applicable
WOT Privacy: Not Applicable
WOT Child Safety: Not Applicable

Website Ranks & Scores

Google Pagerank: Not Applicable
Alexa Rank: Not Applicable
Domain Authority: Not Applicable
Google Pagerank
PR 0 out of 10
PageSpeed Score
91
Siteadvisor Rating
View utterfrugal.com site advisor rating Not Applicable

Where is utterfrugal.com server located?

Hosted IP Address:

192.186.194.69 View other site hosted with utterfrugal.com

Hosted Country:

utterfrugal.com hosted country US utterfrugal.com hosted country

Location Latitude:

33.6013

Location Longitude:

-111.8867

Social Engagement

Facebook Shares: Not Applicable
Facebook Likes: Not Applicable
Facebook Comments: Not Applicable
Twitter Count (Tweets): Not Applicable
Linkedin Shares: Not Applicable
Delicious Shares: Not Applicable

Page Resources Breakdown

View utterfrugal.com HTML resources

Homepage Links Analysis

My blog – Just another WordPress site

Website Inpage Analysis

H1 Headings: Not Applicable H2 Headings: 1
H3 Headings: Not Applicable H4 Headings: 5
H5 Headings: Not Applicable H6 Headings: Not Applicable
Total IFRAMEs: Not Applicable Total Images: Not Applicable
Google Adsense: Not Applicable Google Analytics: Not Applicable

Websites Hosted on Same IP (i.e. 192.186.194.69)

Future Stars - Summer Sports and Specialty Camps in New York

utterfrugal.com favicon - fscamps.com

Kids love Future Stars sports camps. Join us for a summer of sports and fun in Westchester or Long Island. Soccer, Tennis, Baseball, basketball and more.

View utterfrugal.com Pagerank   utterfrugal.com alexa rank 3,339,322   utterfrugal.com website value $ 240.00

403 Forbidden

utterfrugal.com favicon - mediacenterstreams.com

View utterfrugal.com Pagerank   utterfrugal.com alexa rank Not Applicable   utterfrugal.com website value $ 8.95

Pocket Keto – a pocket guide to ketogenic living

utterfrugal.com favicon - pocketketo.com

View utterfrugal.com Pagerank   utterfrugal.com alexa rank Not Applicable   utterfrugal.com website value $ 8.95

NHS Scotland scorecard

utterfrugal.com favicon - nhsscotland-scorecard.org

View utterfrugal.com Pagerank   utterfrugal.com alexa rank Not Applicable   utterfrugal.com website value $ 8.95

WELCOME TO KADIRI LAKSHMI NARASIMHA SWAMY TEMPLE

utterfrugal.com favicon - kadirilakshminarasimhaswamytemple.com

View utterfrugal.com Pagerank   utterfrugal.com alexa rank Not Applicable   utterfrugal.com website value $ 8.95

HTTP Header Analysis

Http-Version: 1.1
Status-Code: 200
Status: 200 OK
Date: Sat, 08 Apr 2017 08:36:01 GMT
Server: Apache/2.4.25
X-Powered-By: PHP/5.4.45
Link: ; rel="https://api.w.org/"
Vary: Accept-Encoding,User-Agent
Content-Encoding: gzip
Content-Length: 3887
Content-Type: text/html; charset=UTF-8

Domain Information for utterfrugal.com

Domain Registrar: GODADDY.COM, LLC utterfrugal.com registrar info
Registration Date: 2017-02-28 7 years 1 month 4 weeks ago
Last Modified: 2017-03-03 7 years 1 month 4 weeks ago
Expiration Date: 2018-02-28 6 years 2 months 2 days ago

Domain Nameserver Information

Host IP Address Country
ns23.domaincontrol.com utterfrugal.com name server information 97.74.101.12 utterfrugal.com server is located in United States United States
ns24.domaincontrol.com utterfrugal.com name server information 173.201.69.12 utterfrugal.com server is located in United States United States

DNS Record Analysis

Host Type TTL Extra
utterfrugal.com A 600 IP:192.186.194.69
utterfrugal.com NS 3600 Target:ns24.domaincontrol.com
utterfrugal.com NS 3600 Target:ns23.domaincontrol.com
utterfrugal.com SOA 600 MNAME:ns23.domaincontrol.com
RNAME:dns.jomax.net
Serial:2017030300
Refresh:28800
Retry:7200
Expire:604800
utterfrugal.com MX 3600 Target:mail.utterfrugal.com
utterfrugal.com TXT 3600 TXT:v=spf1 a mx ptr include:secureserver.net
~all

Similarly Ranked Websites to Utterfrugal

Google

utterfrugal.com favicon - google.com

Search the world's information, including webpages, images, videos and more. Google has many special features to help you find exactly what you're looking for.

View utterfrugal.com Pagerank   Alexa rank for utterfrugal.com 1   website value of utterfrugal.com $ 8,833,062,960.00

Google Calendar - Sign in to Access & Edit Your Schedule

utterfrugal.com favicon - calendar.google.com

Access Google Calendar with a Google account (for personal use) or Google Workspace account (for business use).

View utterfrugal.com Pagerank   Alexa rank for utterfrugal.com 1   website value of utterfrugal.com $ 8,833,062,960.00

Gmail

utterfrugal.com favicon - mail.google.com

Gmail is email that’s intuitive, efficient, and useful. 15 GB of storage, less spam, and mobile access.

View utterfrugal.com Pagerank   Alexa rank for utterfrugal.com 1   website value of utterfrugal.com $ 8,833,062,960.00

Android Apps on Google Play

utterfrugal.com favicon - play.google.com

Enjoy millions of the latest Android apps, games, music, movies, TV, books, magazines & more. Anytime, anywhere, across your devices.

View utterfrugal.com Pagerank   Alexa rank for utterfrugal.com 1   website value of utterfrugal.com $ 8,833,062,960.00

Google Chrome - Download the Fast, Secure Browser from Google

utterfrugal.com favicon - chrome.google.com

Get more done with the new Google Chrome. A more simple, secure, and faster web browser than ever, with Google’s smarts built-in. Download now.

View utterfrugal.com Pagerank   Alexa rank for utterfrugal.com 1   website value of utterfrugal.com $ 8,833,062,960.00

Full WHOIS Lookup for utterfrugal.com

Domain Name: utterfrugal.com
Registrar URL: http://www.godaddy.com
Registrant Name: Adam Smith
Registrant Organization:
Name Server: NS23.DOMAINCONTROL.COM
Name Server: NS24.DOMAINCONTROL.COM
DNSSEC: unsigned

For complete domain details go to:
http://who.godaddy.com/whoischeck.aspx?domain=utterfrugal.com

The data contained in GoDaddy.com, LLC's WhoIs database,
while believed by the company to be reliable, is provided "as is"
with no guarantee or warranties regarding its accuracy. This
information is provided for the sole purpose of assisting you
in obtaining information about domain name registration records.
Any use of this data for any other purpose is expressly forbidden without the prior written
permission of GoDaddy.com, LLC. By submitting an inquiry,
you agree to these terms of usage and limitations of warranty. In particular,
you agree not to use this data to allow, enable, or otherwise make possible,
dissemination or collection of this data, in part or in its entirety, for any
purpose, such as the transmission of unsolicited advertising and
and solicitations of any kind, including spam. You further agree
not to use this data to enable high volume, automated or robotic electronic
processes designed to collect or compile this data for any purpose,
including mining this data for your own personal or commercial purposes.

Please note: the registrant of the domain name is specified
in the "registrant" section. In most cases, GoDaddy.com, LLC
is not the registrant of domain names listed in this database.